Industry Speaker Series June 4, 2003 Texas Instruments: E&PS Supply Chain Apr. 10, 2003 Retail Demand and Supply Chain Management – continued Apr. 17, 2003 Softgoods Demand and Supply Chain Management Apr. 7, 2003 Consumer Electronics Supply Chain Management and Case Study – continued Mar. 24, 2003 Consumer Electronics Supply Chain Management and Case Study – continued Feb. 28, 2003 Wireless Data Management and the Supply Chai n Feb. 20, 2003 Retail Demand and Supply Chain Management Feb. 17, 2003 Consumer Electronics Supply Chain Management and Case Study – continued Jan. 31, 2003 Air Cargo Supply Chain Management and Challe nges Unlock the Value in Your Supply Chain Jan. 28, 2003 Lean Design: Using Blitz QFD to Deliver Maximu m for Minimum Contract Manufacturing in China Jan. 27, 2003 Consumer Electronics Supply Chain Management and Case Study June 23, 2004 Supply Chain Management at BlockBuster June 17, 2004 CEO Forum & Agile Seminar Feb. 16, 2004 Inventory Management Nov. 3, 2003 Logistics Planning with i2 Oct. 3, 2003 Trends in Wholesale Inventory Management Sept. 26, 2003 The Art and Science of Consulting Sept. 12, 2003 The Outsourced Supply Chain July 28, 2003 Supply Chain Management with Oracle July 21, 2003 Supply Chain Management with SAP APO July 21, 2003 Filling a Niche in the Consumer Goods Demand Chain July 18, 2003 Dell Site Visit, Austin Texas July 14, 2003 June 23, 2003 Slide 14
View full slide show




Basic Idea: Sequence Similarity -> Evolution Time • • Beta globin chains of closely related species are highly similar: Observe simple alignments below: Human β chain: MVHLTPEEKSAVTALWGKV NVDEVGGEALGRLL Mouse β chain: MVHLTDAEKAAVNGLWGKVNPDDVGGEALGRLL Human β chain: VVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG Mouse β chain: VVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKK VIN Human β chain: AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGN Mouse β chain: AFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGN Human β chain: VLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH Mouse β chain: MI VI VLGHHLGKEFTPCAQAAFQKVVAGVASALAHKYH There are a total of 27 mismatches, or (147 – 27) / 147 = 81.7 % identical
View full slide show




Sim(Human, Mouse) > Sim(Human, Chicken) Human β chain: MVH L TPEEKSAVTALWGKVNVDEVGGEALGRLL Chicken β chain: MVHWTAEEKQL I TGLWGKVNVAECGAEALARLL Human β chain: VVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG Chicken β chain: IVYPWTQRFF ASFGNLSSPTA I LGNPMVRAHGKKVLT Human β chain: AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGN Chicken β chain: SFGDAVKNLDNIK NTFSQLSELHCDKLHVDPENFRLLGD Human β chain: VLVCVLAHHFGKEFTPPVQAAY QKVVAGVANALAHKYH Chicken β chain: I L I I VLAAHFSKDFTPECQAAWQKLVRVVAHALARKYH -There are a total of 44 mismatches, or (147 – 44) / 147 = 70.1 % identical
View full slide show




Supply Chain Management (1) Supply chain management (SCM)  Management of ____________ flows between and within stages in a supply chain to maximize effectiveness and efficiency Four components of SCM  Supply chain strategy   Supply chain partners   Partners that deliver products and services Supply chain operation   Strategy for managing resources to meet demand The schedule for production activities Supply chain __________  The product delivery processes
View full slide show




ECON OM IC S IN PRACTICE Chain-Linked Consumer Price Index in the News Throughout the last months of 2012 and into early 2013, as Republicans and Democrats argued over the federal budget, chain linking became a hot topic. The fixed-weight version of the consumer price index (CPI) is the one that is used to adjust social security benefits and veteran benefits to price changes. If the chain-linked CPI were used instead, benefits would tend to increase more slowly because in general, the chain-linked CPI increases less than does the fixed-weight CPI (because of product substitution). The nonpartisan Congressional Budget office estimated that if the chain-linked CPI were adopted, it would save the federal government about $145 billion over a ten year period from the lower benefits. THINKING PRACTICALLY THINKING PRACTICALLY 1.Tax brackets are also tied to the fixed-weight CPI. 1.Tax brackets are also tied to the fixed-weight CPI. How would tax revenue be affected if the chain-linked CPI were used How would tax revenue be affected if the chain-linked CPI were used instead? © 2014 Pearson Education, Inc. 20 of 27
View full slide show




Supply Chain Management Elective Jan 18 (Wed) Jan 19 (Thu) Jan 25 (Wed) Jan 26 (Thu) Introduction to Supply Chain Management Supply Chain Network Design (K&S) Data Rich Management (SEJ) Feb 2 (Thu) Feb 8 (Thu) Feb 15 (Wed) Feb 16 (Thu) Feb 22 (Wed) Sourcing from an Ops / People Perspective (K&S China (B)) No Class Aligning Incentives in Supply Chains (Blockbuster) The Negotiations Exercise (Uncle Coco Magic shop) The Supply Chain Game – Part 1 Feb 23 (Thu) Feb 24 (Fri) Mar 1 (Wed) Mar 8 (Wed) Mar 9 (Thu) The Supply Chain Game – Part 2 The Supply Chain Game – Debrief Recycling and Reverse Logistics (Sandvik) Green ProductService Systems (Netafim) Green ProductService Systems (Better Place) Outsourcing and Offshoring (Timbak2) Feb 1 (Wed) Sourcing from an Ops / People Perspective (K&S China (A)) * The Negotiation Exercise on Thursday February 16th and the Supply Chain Game on Wednesday and Thursday February 22-23 will be from 2:45pm to 4:45pm and thus there will be no class on February 8
View full slide show




Chapter 3 Table 12.5 Globin Mutations Associated Phenotype Clinically silent Oxygen binding Anemia Protection against malaria Name Mutation Hemoglobin (Hb) Wayne Single-base deletion in alpha globin gene causes frameshift, changing amino acids 139-141 and adding amino acids Hb Grady Nine extra bases add three amino acids between amino acids 118 and 119 of alpha chain Hb Chesapeake Change from arginine to leucine at amino acid 92 of beta chain Hb McKees Rocks Change from tyrosine to STOP codon at amino acid 145 in beta chain Hb Constant Spring Change from STOP codon to glutamine elongates alpha chain Hb S Change from glutamic acid to valine at amino acid 6 in beta chain causes sickling Hb Leiden Amino acid 6 deleted from beta chain Hb C Change from glutamic acid to lysine at amino acid 6 in beta chain causes sickling © McGraw-Hill Education. 12-47
View full slide show




SAP Supply Chain Management Demand & Supply Planning Demand Planning & Forecasting Production Planning & Detailed Scheduling Manufacturing Visibility & Execution & Collaboration MRP based Detailed Scheduling Outbound Processing Cross Docking Sales Order Processing Freight Management Real World Awareness Billing Planning & Dispatching Strategic Supply Chain Supply Chain Analytics Design Copyright SAP AG Magal and 2008 Supplier Collaboration Physical Inventory Service Parts Order Fulfillment Rating & Billing & Settlement Supply Chain Event Management Supply Network Collaboration Warehousing & Storage Driver & Asset Management Network Collaboration Auto ID / RFID and Sensor Integration Supply Chain Risk Management Customer Collaboration Sales & Operations Planning Outsourced Manufacturing Demand Planning in MS Excel Word ! Essentials of Business Processes and Information Systems | © 2009 SAP NetWeaver Inbound Processing & Receipt Confirmation Transportation 9 Service Parts Planning Invoicing Order Fulfillment Supply Chain Management with Duet Distribution Planning Purchase Order Processing Warehousing Supply Chain Visibility Supply Network Planning Strategic Sourcing Procurement Manufacturing Safety Stock Planning
View full slide show




Supply Chain Management It involves the management of information between and among stages in a supply chain to maximize total supply chain effectiveness and profitability • • • • Supply chain strategy Supply chain partner Supply chain operation Supply chain logistics
View full slide show




Connection to real world  Calculus-Based Algebra-Based High School (Algebra-Based) Tell me a story about a situation where net force might be applicable. – A tow truck pulling someone out a ditch is an example of net force. The cars gravidity is pulling against the truck and the truck is pulling against the car. The truck needs to exert more force than the car to pull it out of the ditch. ok – An example of this is if Student B’s car stalls out and he needs two of his friends, Willie and Bob, to help him push while he steers the wheel. The net force is equivalent to the force applied on the car by Willie (F_w) plus the force applied on the car by Bob (F_b). Therefore, F_xnet = F_w + F_b.
View full slide show




Management Information Systems Chapter 9 Achieving Operational Excellence and Customer Intimacy: Enterprise Applications Supply Chain Management Systems • The supply chain • Information and supply chain management • Supply chain management applications • Supply chain management and the Internet • Demand-driven supply chains: From push to pull manufacturing and efficient customer response • Business value of supply chain management systems 9.7 © 2007 by Prentice Hall
View full slide show




DUTCH AWEARNESS: IMPLEMENTING A COOPERATIVE ECONOMY THROUGH CHAIN INVESTMENT / Digital Circular economy In collaboration with Dutch aWEARness and PGGM, business models highlighting a cooperative economy and their financial effects on the value chain were explored . Technology: Circular Track and Trace CCMS is a cloud data based platform sofware program, where chain partners in the extended supply chain can share selected information related to the products they make. It includes a portal to the customers who buy the products and portals to supply chain partners and the government. Tracking and tracing of each step in the supply chain. 9
View full slide show




DAXPY Chaining: CRAY-1   CRAY-1 has one memory access pipe either for load or store (not for both at the same time) 3 chains    Chain 1: LV V3 Chain 2: LV V1 + MULV V2,F0,V1 + ADDV V4,V2,V3 Chain 3: SV V4 Time Chain 1: 12 n Chain 2: 25 AM LaCASA n Chain 3: 12 n 22
View full slide show




Rule Operations • • • • -I -A -D -R Add a rule to the head of a chain Appends a rule to the tail of a chain Deletes a rule that matches the specifiers Replaces a rule in a chain Syntax iptables -t table -OP chain specifiers iptables -t table -OP chain line# specifiers iptables -OP chain specifiers
View full slide show




• Chain of Responsibility simplifies object interconnections. Instead of senders and receivers maintaining references to all candidate receivers, each sender keeps a single reference to the head of the chain, and each receiver keeps a single immediate successor in be theused chain. • reference The Chain to of its Responsibility pattern can to deal with long if-then-else statements. A much more descriptive path can be made by coding it into a framework of successive objects that keep a reference to one another in the path, so that a pathofisResponsibility built by the objects • logical The Chain patternthemselves. is often used in conjunction with the Composite structural pattern, with a component’s parent acting as its successor. Chapter 5 – Page 11 Chain of Responsibility Pattern Advantages
View full slide show




Integrated Supply Chain Phase 1: Independent supply-chain entities Suppliers Phase 2: Internal integration Suppliers Purchasing Production Distribution Purchasing Production Distribution Customers Customers Internal supply chain Materials management department Phase 3: Supply-chain integration Suppliers Internal supply chain Customers Integrated supply chain Figure 11.5 To Accompany Krajewski & Ritzman Operations Management: Strategy and Analysis, Sixth Edition © 2002 Prentice Hall, Inc. All rights reserved.
View full slide show




Integrated Supply Chain Phase 1: Independent supply-chain entities Suppliers Phase 2: Internal integration Suppliers Purchasing Production Distribution Purchasing Production Distribution Internal supply chain Materials management department Phase 3: Supply-chain integration Suppliers Internal supply chain Customers Integrated supply chain Customers Customers
View full slide show




Radical Chain Mechanism  Chain propagation: a step in a chain reaction characterized by the reaction of a reactive intermediate and a molecule to form a new reactive intermediate and a new molecule CH3 CH2• + H Cl Step 2: CH3 CH2 H + •Cl Step 3: CH3 CH2•  + Cl Cl CH3 CH2 Cl + •Cl Chain length: the number of times the cycle of chain propagation steps repeats in a chain reaction 8-23
View full slide show




The proposed accelerator-centric architecture template • Gateways controlled by ILP to manage the whole chain of accelerators Point point connections 1. DMA to brings dataaccelerator to the input gateway’s SPM Input – much 2. gateway receives data and startsmemory to pass data through the chain SPM to memory receive/send data from/to No requirement 3. works on data data transfer Chain Not many DMA – Control lines from ILP to gateways 4. Output gateway gathers data in SPM for configuration 5. DMA data to from memory – brings Interrupt lines gateways to ILP Autonomous ACC chain: – Point to point connections in chain with small buffer in between Light ILP synchronization load no matter how many accelerators – Chain works independence of ILP 3 2 4 1 5 24
View full slide show