Industry Speaker Series June 4, 2003 Texas Instruments: E&PS Supply Chain Apr. 10, 2003 Retail Demand and Supply Chain Management – continued Apr. 17, 2003 Softgoods Demand and Supply Chain Management Apr. 7, 2003 Consumer Electronics Supply Chain Management and Case Study – continued Mar. 24, 2003 Consumer Electronics Supply Chain Management and Case Study – continued Feb. 28, 2003 Wireless Data Management and the Supply Chai n Feb. 20, 2003 Retail Demand and Supply Chain Management Feb. 17, 2003 Consumer Electronics Supply Chain Management and Case Study – continued Jan. 31, 2003 Air Cargo Supply Chain Management and Challe nges Unlock the Value in Your Supply Chain Jan. 28, 2003 Lean Design: Using Blitz QFD to Deliver Maximu m for Minimum Contract Manufacturing in China Jan. 27, 2003 Consumer Electronics Supply Chain Management and Case Study June 23, 2004 Supply Chain Management at BlockBuster June 17, 2004 CEO Forum & Agile Seminar Feb. 16, 2004 Inventory Management Nov. 3, 2003 Logistics Planning with i2 Oct. 3, 2003 Trends in Wholesale Inventory Management Sept. 26, 2003 The Art and Science of Consulting Sept. 12, 2003 The Outsourced Supply Chain July 28, 2003 Supply Chain Management with Oracle July 21, 2003 Supply Chain Management with SAP APO July 21, 2003 Filling a Niche in the Consumer Goods Demand Chain July 18, 2003 Dell Site Visit, Austin Texas July 14, 2003 June 23, 2003 Slide 14
View full slide show




Golf Cart: Controls • Do not floor the accelerator • To set the parking brake, push in the top of the brake pedal so that it clicks and holds – DO NOT PUSH PARKING BRAKE TOO HARD • To release parking brake, simply put the cart in the direction you would like to go, and press on the accelerator • Do not change directions while in motion - come to a complete stop first • Check the tires
View full slide show




Basic Idea: Sequence Similarity -> Evolution Time • • Beta globin chains of closely related species are highly similar: Observe simple alignments below: Human β chain: MVHLTPEEKSAVTALWGKV NVDEVGGEALGRLL Mouse β chain: MVHLTDAEKAAVNGLWGKVNPDDVGGEALGRLL Human β chain: VVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG Mouse β chain: VVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKK VIN Human β chain: AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGN Mouse β chain: AFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGN Human β chain: VLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH Mouse β chain: MI VI VLGHHLGKEFTPCAQAAFQKVVAGVASALAHKYH There are a total of 27 mismatches, or (147 – 27) / 147 = 81.7 % identical
View full slide show




Sim(Human, Mouse) > Sim(Human, Chicken) Human β chain: MVH L TPEEKSAVTALWGKVNVDEVGGEALGRLL Chicken β chain: MVHWTAEEKQL I TGLWGKVNVAECGAEALARLL Human β chain: VVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG Chicken β chain: IVYPWTQRFF ASFGNLSSPTA I LGNPMVRAHGKKVLT Human β chain: AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGN Chicken β chain: SFGDAVKNLDNIK NTFSQLSELHCDKLHVDPENFRLLGD Human β chain: VLVCVLAHHFGKEFTPPVQAAY QKVVAGVANALAHKYH Chicken β chain: I L I I VLAAHFSKDFTPECQAAWQKLVRVVAHALARKYH -There are a total of 44 mismatches, or (147 – 44) / 147 = 70.1 % identical
View full slide show




Supply Chain Management (1) Supply chain management (SCM)  Management of ____________ flows between and within stages in a supply chain to maximize effectiveness and efficiency Four components of SCM  Supply chain strategy   Supply chain partners   Partners that deliver products and services Supply chain operation   Strategy for managing resources to meet demand The schedule for production activities Supply chain __________  The product delivery processes
View full slide show




ECON OM IC S IN PRACTICE Chain-Linked Consumer Price Index in the News Throughout the last months of 2012 and into early 2013, as Republicans and Democrats argued over the federal budget, chain linking became a hot topic. The fixed-weight version of the consumer price index (CPI) is the one that is used to adjust social security benefits and veteran benefits to price changes. If the chain-linked CPI were used instead, benefits would tend to increase more slowly because in general, the chain-linked CPI increases less than does the fixed-weight CPI (because of product substitution). The nonpartisan Congressional Budget office estimated that if the chain-linked CPI were adopted, it would save the federal government about $145 billion over a ten year period from the lower benefits. THINKING PRACTICALLY THINKING PRACTICALLY 1.Tax brackets are also tied to the fixed-weight CPI. 1.Tax brackets are also tied to the fixed-weight CPI. How would tax revenue be affected if the chain-linked CPI were used How would tax revenue be affected if the chain-linked CPI were used instead? © 2014 Pearson Education, Inc. 20 of 27
View full slide show




Supply Chain Management Elective Jan 18 (Wed) Jan 19 (Thu) Jan 25 (Wed) Jan 26 (Thu) Introduction to Supply Chain Management Supply Chain Network Design (K&S) Data Rich Management (SEJ) Feb 2 (Thu) Feb 8 (Thu) Feb 15 (Wed) Feb 16 (Thu) Feb 22 (Wed) Sourcing from an Ops / People Perspective (K&S China (B)) No Class Aligning Incentives in Supply Chains (Blockbuster) The Negotiations Exercise (Uncle Coco Magic shop) The Supply Chain Game – Part 1 Feb 23 (Thu) Feb 24 (Fri) Mar 1 (Wed) Mar 8 (Wed) Mar 9 (Thu) The Supply Chain Game – Part 2 The Supply Chain Game – Debrief Recycling and Reverse Logistics (Sandvik) Green ProductService Systems (Netafim) Green ProductService Systems (Better Place) Outsourcing and Offshoring (Timbak2) Feb 1 (Wed) Sourcing from an Ops / People Perspective (K&S China (A)) * The Negotiation Exercise on Thursday February 16th and the Supply Chain Game on Wednesday and Thursday February 22-23 will be from 2:45pm to 4:45pm and thus there will be no class on February 8
View full slide show




Chapter 3 Table 12.5 Globin Mutations Associated Phenotype Clinically silent Oxygen binding Anemia Protection against malaria Name Mutation Hemoglobin (Hb) Wayne Single-base deletion in alpha globin gene causes frameshift, changing amino acids 139-141 and adding amino acids Hb Grady Nine extra bases add three amino acids between amino acids 118 and 119 of alpha chain Hb Chesapeake Change from arginine to leucine at amino acid 92 of beta chain Hb McKees Rocks Change from tyrosine to STOP codon at amino acid 145 in beta chain Hb Constant Spring Change from STOP codon to glutamine elongates alpha chain Hb S Change from glutamic acid to valine at amino acid 6 in beta chain causes sickling Hb Leiden Amino acid 6 deleted from beta chain Hb C Change from glutamic acid to lysine at amino acid 6 in beta chain causes sickling © McGraw-Hill Education. 12-47
View full slide show




SAP Supply Chain Management Demand & Supply Planning Demand Planning & Forecasting Production Planning & Detailed Scheduling Manufacturing Visibility & Execution & Collaboration MRP based Detailed Scheduling Outbound Processing Cross Docking Sales Order Processing Freight Management Real World Awareness Billing Planning & Dispatching Strategic Supply Chain Supply Chain Analytics Design Copyright SAP AG Magal and 2008 Supplier Collaboration Physical Inventory Service Parts Order Fulfillment Rating & Billing & Settlement Supply Chain Event Management Supply Network Collaboration Warehousing & Storage Driver & Asset Management Network Collaboration Auto ID / RFID and Sensor Integration Supply Chain Risk Management Customer Collaboration Sales & Operations Planning Outsourced Manufacturing Demand Planning in MS Excel Word ! Essentials of Business Processes and Information Systems | © 2009 SAP NetWeaver Inbound Processing & Receipt Confirmation Transportation 9 Service Parts Planning Invoicing Order Fulfillment Supply Chain Management with Duet Distribution Planning Purchase Order Processing Warehousing Supply Chain Visibility Supply Network Planning Strategic Sourcing Procurement Manufacturing Safety Stock Planning
View full slide show




Supply Chain Management It involves the management of information between and among stages in a supply chain to maximize total supply chain effectiveness and profitability • • • • Supply chain strategy Supply chain partner Supply chain operation Supply chain logistics
View full slide show




Braking system Components: • Dual US Brake master cylinders, 7/8” bore • Wilwood reverse mount pedal • Polaris Outlaw front rotors and calipers • Polaris Ranger rear rotors and calipers • AN-3 flex steel brake lines • Polaris 10mm pressure switch • Polaris brake light
View full slide show




DC-DC Converter Drives • • • • Principle of Power Control Principle of Regenerative Brake Control Principle of Rheostatic Brake Control Combined Regenerative and Rheostatic Brake Control • Two and Four Quadrant DC – DC Converter Drives ECE 442 Power Electronics 1
View full slide show




Second phase: Adding the High Beam Modify your circuit design by adding a fourth light bulb and an additional switch to the circuit in order to simulate the high beam. Draw a new circuit of the lighting system in Multisim. As before, when the main switch is turned on, the low beam headlight and the tail light should turn on. The brake light should turn on when the pushbutton switch is on. When an additional switch is turned on in the modified circuit, the high beam (fourth light) should turn on. Show your modified circuit to the instructor or TA to verify your design, and then proceed to build the system with your team. Show your instructor or TA that you can turn on the high beam and at the same time press the brake switch to turn on the brake light.
View full slide show




Car Example Software Driving User Program Operate Car Abstract Interface Device Interface Modules Hardware Interface Hardware Brake Pedal Brake Controller Brake Line Brakes Accelerator Throttle Controller Fuel Engine Steering Wheel Steering system Interface Steering Column Wheel Angle Devic es
View full slide show




Sample IC4 Code #define #define #define #define DRIVE_ENCODER DRIVE_MOTOR TURN_MOTOR MOVE_TICKS 1 1 2 30 void main() { enable_bidir_encoder(DRIVE_ENCODER); reset_encoder(DRIVE_ENCODER); brake(TURN_MOTOR); motor(DRIVE_MOTOR, 100); while ( read_encoder(DRIVE_ENCODER) < MOVE_TICKS ); brake(DRIVE_MOTOR); motor(DRIVE_MOTOR, -100); while ( read_encoder(DRIVE_ENCODER) > 0 ); brake(DRIVE_MOTOR); return; } 22 March 2004 AAAI Spring Symposium 2004 6
View full slide show




When friction brake is applied, the kinetic energy of a moving car is converted into heat energy in the brake pads and later, ambient air. In this case, the energy is transformed, not created. 50 mph 0 mph 0 (Kinetic Energy) (1/2)mv2 (Kinetic Energy) Heat energy in brake pad based on notes of P. Hsu 2007 17
View full slide show




When friction brake is applied, the kinetic energy of a moving car is converted into heat energy in the brake pads and later, ambient air. In this case, the energy is transformed, not created. 50 mph 0 mph 0 (Kinetic Energy) (1/2)mv2 (Kinetic Energy) Heat energy in brake pad based on notes of P. Hsu 2007 15
View full slide show